PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.H01387.1.p
Common NameLOC105951594, MIMGU_mgv1a022795mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 351aa    MW: 38951.7 Da    PI: 7.5174
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.H01387.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.82.6e-34187244259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s++prsYYrCt+++Cpvkk+vers +dp++v++tYeg+Hnh+
  Migut.H01387.1.p 187 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCPVKKRVERSFQDPSIVITTYEGQHNHH 244
                       8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-35171246IPR003657WRKY domain
SuperFamilySSF1182905.89E-30178246IPR003657WRKY domain
PROSITE profilePS5081132.386181246IPR003657WRKY domain
SMARTSM007742.5E-40186245IPR003657WRKY domain
PfamPF031061.0E-26187244IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MSEELREFYY HQPYSDDQRR NTSGSGGGGG TTFPYSGGQY SSTYNTGDSS SVHAHYLQMF  60
DPSYVSFAEF LHGSADHNSL INSAPGFSPK YSSPAAVIKE EEKRPPPVET PATPNSSISS  120
SSTEAAAAAA AEEDSNKGST GKKATTAEDG EGTSKKESKT KIIKKGEKKE KQQKVAFMTK  180
SEVDHLEDGY RWRKYGQKAV KNSPYPRSYY RCTTQKCPVK KRVERSFQDP SIVITTYEGQ  240
HNHHLPASLR GNMAGMSFAA AGSSSMFAPP ASFSMQDQIS FPQEILLSQN NNMPPQHHQH  300
HHNLYSYDGG RSTRNSYDQQ QQQQQLFQQF TDDYGLLQDV IPPLFPKQEH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-30176247778Probable WRKY transcription factor 4
1wj2_A2e-30176247778Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00168DAPTransfer from AT1G29860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012830503.10.0PREDICTED: probable WRKY transcription factor 71
TrEMBLA0A022RS020.0A0A022RS02_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14852475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.16e-49WRKY DNA-binding protein 71